PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.2G385000.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family GRAS
Protein Properties Length: 458aa    MW: 49456.4 Da    PI: 5.265
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.2G385000.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS303.26.2e-93614542373
                GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlar..svselykalppsetseknsseelaalkl..fsevs 88 
                         ++lL++cA+a++++d++l+q++L+ l+++a pdgd++qRl+a f+ AL ar +r   ++ + +a+++  +s   ++++++a++l  f++++
  Sevir.2G385000.1.p  61 EQLLVHCANAIEANDATLTQQILWVLNNIAPPDGDSNQRLTAAFLCALVARASRtgACKAVTAAVAAAVESAALHVHRFTAVELasFVDLT 151
                         79***************************************************943444555555444444444777777777789***** PP

                GRAS  89 PilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg......skeeleetgerLakfAeelg 173
                         P+++f++ +aN aIleaveg   vH++ ++ ++++Q p+L++ LasR+egpp lR+T+ + ++++         ++ e+g +L +fA++ +
  Sevir.2G385000.1.p 152 PWHRFGYTAANAAILEAVEGFPVVHVVELGTTHCMQIPTLIDMLASRAEGPPILRLTVADVASTTsapppaLDMSYDELGAKLVNFARSRN 242
                         **********************************************************9988777888887777899************** PP

                GRAS 174 vpfefnvl.......vakrledleleeLrvkpgEalaVnlvlqlhrlldesvsles.......erdevLklvkslsPkvvvvveqeadhns 250
                         ++++f+v+        ++ +++l++++L  +  Eal+Vn+++ lh ++de++ +          r+ +Lk +++l P++vvvve++ad ++
  Sevir.2G385000.1.p 243 MSMDFRVVptspgdaFTSLIDQLRVQQLVSDGTEALVVNCHMLLHAVPDETAGSVMslaqpvsLRTMLLKSLRTLDPNLVVVVEEDADFTA 333
                         ********988888666778888999998888****************8876443334445557889************************ PP

                GRAS 251 esFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklll 341
                          + + r+  a+++ +  +d++++ lp+ se+r+++E+e +g++++nv+a+eg er+er+e  ++W +r+++aGF++v+++e+aa ++k++l
  Sevir.2G385000.1.p 334 DDVVGRLRAAFNFLWIPYDAVDTFLPKGSEQRRWYEAE-IGWKVENVLAQEGVERVERQEDRARWGQRMRSAGFRAVAFGEEAAGEVKAML 423
                         **************************************.**************************************************** PP

                GRAS 342 rkvksdgyrveeesgslvlgWkdrpLvsvSaW 373
                         ++++  g+ ++ e++ lvl+Wk++++v++SaW
  Sevir.2G385000.1.p 424 NEHA-AGWGMKREDDDLVLTWKGHNVVFASAW 454
                         ****.889999********************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098546.61634436IPR005202Transcription factor GRAS
PfamPF035142.1E-9061454IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 458 aa     Download sequence    Send to blast
MMQFTHTAPP PPPLHPNGHG GLGLGLFLDV GAPRARPWPG SFPTPASKIS LGNLNSTSCM  60
EQLLVHCANA IEANDATLTQ QILWVLNNIA PPDGDSNQRL TAAFLCALVA RASRTGACKA  120
VTAAVAAAVE SAALHVHRFT AVELASFVDL TPWHRFGYTA ANAAILEAVE GFPVVHVVEL  180
GTTHCMQIPT LIDMLASRAE GPPILRLTVA DVASTTSAPP PALDMSYDEL GAKLVNFARS  240
RNMSMDFRVV PTSPGDAFTS LIDQLRVQQL VSDGTEALVV NCHMLLHAVP DETAGSVMSL  300
AQPVSLRTML LKSLRTLDPN LVVVVEEDAD FTADDVVGRL RAAFNFLWIP YDAVDTFLPK  360
GSEQRRWYEA EIGWKVENVL AQEGVERVER QEDRARWGQR MRSAGFRAVA FGEEAAGEVK  420
AMLNEHAAGW GMKREDDDLV LTWKGHNVVF ASAWAPS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A3e-19624546374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2432380.0AC243238.1 Panicum virgatum clone PV_ABa020-K10, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004958182.10.0PREDICTED: scarecrow-like protein 32
SwissprotQ9SN221e-168SCL32_ARATH; Scarecrow-like protein 32
TrEMBLK3ZT660.0K3ZT66_SETIT; Uncharacterized protein
STRINGSi029796m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP56973759
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G49950.11e-158GRAS family protein